제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse Ly-49D mAb (A26719)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T cells (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse Ly-49D mAb (A26719, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse Ly-49D mAb (A26719, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse Ly-49D mAb
Catalog No.	A26719
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69648-ABflo647

Background

Predicted to enable carbohydrate binding activity. Predicted to act upstream of or within cell adhesion. Located in external side of plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 66-263 of mouse Ly-49D (NP_001239506.1).
Sequence	TNIFQYGQQKHELKEFLKHHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQNILCDKTRTVLDYLQHTGRGVKVYWFCYGMKCYYFVMDRKPWSRCKQSCQNSSLTLLKIDDEDELKFLQLVVPSDSCWIGLSYDNKKKDWAWIDNRPSKLALNTTKYNIRDGGCMFLSKTRLDNNYCDQSFICICGKRLDKFPH
Gene ID
Swiss Prot
Synonyms	Chok; Ly49d; Klra32; Klra33; Ly-49d; ly49r<129>
Calculated MW	31kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.