Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Pig
Product name | ABflo® 647 Rabbit anti-Pig CD19 mAb |
---|---|
Catalog No. | A23396 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC60222-ABf647 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-305 of pig CD19 (NP_612564.1). |
---|---|
Sequence | PQEPYLVEAQEGGNAVLPCLEGPSEGPPEQLAWFRGSQSTPFLELSLGLPGLGIHVGPLGTLKEPQGTLLFIFNVSDQMGGFYLCQQGPPSDQSWQPGWTVNVKGSGELLRWNASDLNDPSCDLGARSSEGRRSSSSHPTRSKLYVWAKNQAKVLHTDLTCPPPNSTVNQSNSHDLTVAPGSTLSLSCGSSRASLVRGPISWIHVRPKKHVKLLSLNLTEDAQLREMWVMGSLRGKAVLLLPEATAQDADTYHCNHGSVTTQMRLKVTARSVWHWLLETGGW |
Gene ID | |
Swiss Prot | |
Synonyms | B4; CVID3 |
Calculated MW | |
Observed MW |
Reactivity | Pig |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Membrane, Single-pass type I membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.