Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Monkey
Product name | ABflo® 700 Rabbit anti-Human/Monkey CD19 mAb |
---|---|
Catalog No. | A27165 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57915-ABflo700 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-292 of monkey CD19 (XP_005591597.1). |
---|---|
Sequence | PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK |
Gene ID | |
Swiss Prot | |
Synonyms | CD19 |
Calculated MW | |
Observed MW |
Reactivity | Human, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.