제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb (A23009)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Monkey

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Raji cells was used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).

Flow cytometry:1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Monkey PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).The cells were simultaneously stained with FITC Mouse anti-Human CD3 Antibody.

Flow cytometry:1X10^6 Monkey PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).The cells were simultaneously stained with ABflo® 488 Rabbit anti-Human CD27 mAb（A22063，5 μl/Test）.

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb (A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 RRabbit anti-Human/Monkey CD19 mAb (A23009, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb
Catalog No.	A23009
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57915-ABf647

Background

This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-292 of monkey CD19.
Sequence	PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK
Gene ID
Swiss Prot
Synonyms
Calculated MW	63kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	membrane.