제품 > 항체 > 단일클론항체(mAb)

ACC1 Rabbit mAb (A19627)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ACC1 Rabbit mAb (A19627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Mouse heart, using ACC1 Rabbit mAb (A19627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - ACC1 Rabbit mAb (A19627)

Immunohistochemistry analysis of paraffin-embedded mouse testis using ACC1 Rabbit mAb (A19627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat kidney using ACC1 Rabbit mAb (A19627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - ACC1 Rabbit mAb (A19627)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg ACC1 antibody (A19627). Western blot was performed from the immunoprecipitate using ACC1 (A19627) at a dilution of 1:1000.

Overview

Product name	ACC1 Rabbit mAb
Catalog No.	A19627
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2201

Background

Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ACC1 (Q13085).
Sequence	RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE
Gene ID
Swiss Prot
Synonyms	ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha
Calculated MW	266kDa
Observed MW	277kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, HepG2, C6, Mouse heart
Cellular location	actin cytoskeleton, cytosol, fibrillar center, mitochondrion
Customer validation	WB(Mus musculus, Homo sapiens) IHC(Homo sapiens,Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ACC1 Rabbit mAb images

Western blot - ACC1 Rabbit mAb (A19627)

Immunohistochemistry - ACC1 Rabbit mAb (A19627)

Immunoprecipitation - ACC1 Rabbit mAb (A19627)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg ACC1 antibody (A19627). Western blot was performed from the immunoprecipitate using ACC1 (A19627) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.