제품 > 항체 > 다중클론항체(pAb)

ACSM1 Rabbit pAb (A24752)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of ACSM1 in paraffin-embedded human liver tissue using ACSM1 Rabbit pAb (A24752) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ACSM1 in paraffin-embedded human colon tissue using ACSM1 Rabbit pAb (A24752) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	ACSM1 Rabbit pAb
Catalog No.	A24752
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables CoA-ligase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Located in mitochondrial matrix.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2).
Sequence	ILYRLQLSKAKGIVTIDALASEVDSIASQCPSLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPG
Gene ID
Swiss Prot
Synonyms	BUCS1; MACS1
Calculated MW	65kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Mitochondrion matrix