제품 > 항체 > 다중클론항체(pAb)

ACTL8 Rabbit pAb (A14937)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using ACTL8 Rabbit pAb (A14937) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	ACTL8 Rabbit pAb
Catalog No.	A14937
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in epithelial cell differentiation. Predicted to be located in cytoplasm. Predicted to be part of dynactin complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-366 of human ACTL8 (NP_110439.2).
Sequence	MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
Gene ID
Swiss Prot
Synonyms	CT57; ACTL8
Calculated MW	41kDa
Observed MW	41-50kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HepG2, Mouse testis, Mouse pancreas, Mouse brain
Cellular location	Cytoplasm, cytoskeleton