제품 > 항체 > 단일클론항체(mAb)

ACTN3 Rabbit mAb (A19631)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ACTN3 Rabbit mAb (A19631) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - ACTN3 Rabbit mAb (A19631)

Immunofluorescence analysis of rat bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ACTN3 Rabbit mAb
Catalog No.	A19631
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2202

Background

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human ACTN3 (Q08043).
Sequence	DRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLGEVE
Gene ID
Swiss Prot
Synonyms	ACTN3D
Calculated MW	103kDa
Observed MW	103kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse skeletal muscle, Rat skeletal muscle
Cellular location	Cortical actin cytoskeleton, Cytosol, Extracellular exosome, Plasma membrane, Z disc

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ACTN3 Rabbit mAb images

Western blot - ACTN3 Rabbit mAb (A19631)

Immunofluorescence - ACTN3 Rabbit mAb (A19631)

Immunofluorescence analysis of rat bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - ACTN3 Rabbit mAb (A19631)

Immunofluorescence analysis of mouse bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.