제품 > 항체 > 단일클론항체(mAb)

ACTR1B Rabbit mAb (A21140)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using ACTR1B Rabbit mAb (A21140) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat brain, using ACTR1B Rabbit mAb (A21140) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - ACTR1B Rabbit mAb (A21140)

Immunohistochemistry analysis of paraffin-embedded rat heart using ACTR1B Rabbit mAb (A21140) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat testis using ACTR1B Rabbit mAb (A21140) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - ACTR1B Rabbit mAb (A21140)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg ACTR1B antibody (A21140). Western blot was performed from the immunoprecipitate using ACTR1B antibody (A21140) at a dilution of1:2000.

Overview

Product name	ACTR1B Rabbit mAb
Catalog No.	A21140
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3033

Background

This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-376 of human ACTR1B (NP_005726.1).
Sequence	LSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
Gene ID
Swiss Prot
Synonyms	PC3; ARP1B; CTRN2; ACTR1B
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Hep G2, Jurkat, U-87MG, Rat brain
Cellular location	Cytoplasm, Centrosome, Cytoskeleton, Microtubule organizing center