제품 > 항체 > 다중클론항체(pAb)

ADGRD1 Rabbit pAb (A12629)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ADGRD1 Rabbit pAb (A12629) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	ADGRD1 Rabbit pAb
Catalog No.	A12629
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The adhesion G-protein-coupled receptors (GPCRs), including GPR133, are membrane-bound proteins with long N termini containing multiple domains. GPCRs, or GPRs, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins (summary by Bjarnadottir et al., 2004 [PubMed 15203201]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2).
Sequence	FHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
Gene ID
Swiss Prot
Synonyms	PGR25; GPR133; ADGRD1
Calculated MW	97kDa
Observed MW	105kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, LO2, 293T, Mouse kidney, Mouse liver, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein