제품 > 항체 > 다중클론항체(pAb)

ADH1A/ADH1B/ADH1C Rabbit pAb (A18581)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse lung, using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - ADH1A/ADH1B/ADH1C Rabbit pAb (A18581)

Immunofluorescence analysis of paraffin-embedded Human liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded Rat liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded Mouse liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	ADH1A/ADH1B/ADH1C Rabbit pAb
Catalog No.	A18581
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 270-370 of human ADH1A/ADH1B/ADH1C (NP_000659.2).
Sequence	IGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIR
Gene ID
Swiss Prot
Synonyms	ADH1A/ADH1B/ADH1C
Calculated MW
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse lung
Cellular location	cytosol, nucleoplasm, plasma membrane
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) IF(Mus musculus)