Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | AGTRAP Rabbit pAb |
---|---|
Catalog No. | A12178 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3). |
---|---|
Sequence | ILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGR |
Gene ID | |
Swiss Prot | |
Synonyms | ATRAP; AGTRAP |
Calculated MW | 17kDa |
Observed MW | 20kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, HT-29, U-87MG, BxPC-3, Mouse kidney, Mouse testis, Mouse heart, Rat kidney, Rat heart |
Cellular location | Cytoplasmic vesicle membrane, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.