제품 > 항체 > 단일클론항체(mAb)

AHCY Rabbit mAb (A2756)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using AHCY Rabbit mAb (A2756) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - AHCY Rabbit mAb (A2756)

Immunoprecipitation analysis of 300 μg extracts of HT-29 cells using 3 μg AHCY antibody (A2756). Western blot was performed from the immunoprecipitate using AHCY antibody (A2756) at a dilution of 1:1000.

Overview

Product name	AHCY Rabbit mAb
Catalog No.	A2756
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2674

Background

S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AHCY (P23526).
Sequence	GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
Gene ID
Swiss Prot
Synonyms	SAHH; adoHcyase; AHCY
Calculated MW	48kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HT-29, HepG2, A375, K-562, Mouse pancreas, Mouse liver, Mouse kidney, Rat kidney
Cellular location	Cytoplasm, Melanosome
Customer validation	WB(Homo sapiens, Mus musculus)