제품 > 항체 > 다중클론항체(pAb)

AIRE Rabbit pAb (A1767)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using AIRE antibody (A1767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - AIRE Rabbit pAb (A1767)

Immunofluorescence analysis of NIH/3T3 cells using AIRE Rabbit pAb (A1767) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using AIRE Rabbit pAb (A1767) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using AIRE Rabbit pAb (A1767) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	AIRE Rabbit pAb
Catalog No.	A1767
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating the expression of autoantigens and negative selection of autoreactive T-cells in the thymus. Mutations in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy with candidiasis and ectodermal dystrophy (APECED).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 30-130 of human AIRE (NP_000374.1).
Sequence	HALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPT
Gene ID
Swiss Prot
Synonyms	APS1; APSI; PGA1; AIRE1; APECED
Calculated MW	58kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, U-937, HT-29, OVCAR3, SW620, Mouse kidney, Mouse liver
Cellular location	Cytoplasm, Nucleus