제품 > 항체 > 다중클론항체(pAb)

AJAP1 Rabbit pAb (A17184)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using AJAP1 Rabbit pAb (A17184) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	AJAP1 Rabbit pAb
Catalog No.	A17184
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables beta-catenin binding activity. Involved in negative regulation of cell-matrix adhesion; negative regulation of wound healing; and regulation of polarized epithelial cell differentiation. Located in several cellular components, including adherens junction; basolateral plasma membrane; and cell-cell contact zone. Is spanning component of plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AJAP1 (NP_061324.1).
Sequence	TLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVA
Gene ID
Swiss Prot
Synonyms	MOT8; SHREW1; SHREW-1; AJAP1
Calculated MW	45kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, Mouse pancreas
Cellular location	adherens junction, apical plasma membrane, basolateral plasma membrane, cell-cell contact zone, cytoplasmic side of plasma membrane, plasma membrane