Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | AJAP1 Rabbit pAb |
---|---|
Catalog No. | A17184 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AJAP1 (NP_061324.1). |
---|---|
Sequence | TLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVA |
Gene ID | |
Swiss Prot | |
Synonyms | MOT8; SHREW1; SHREW-1; AJAP1 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, Mouse pancreas |
Cellular location | adherens junction, apical plasma membrane, basolateral plasma membrane, cell-cell contact zone, cytoplasmic side of plasma membrane, plasma membrane |
* For research use only. Not for therapeutic or diagnostic purposes.