Review (2)Publications (23) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ALIX / PDCD6IP Rabbit pAb |
---|---|
Catalog No. | A2215 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALIX / PDCD6IP (NP_037506.2). |
---|---|
Sequence | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDIS |
Gene ID | |
Swiss Prot | |
Synonyms | AIP1; ALIX; HP95; DRIP4; MCPH29 |
Calculated MW | 96kDa |
Observed MW | 105kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, LO2, Jurkat, Rat brain |
Cellular location | Cytoplasm, Melanosome, centrosome, cytoskeleton, cytosol, microtubule organizing center |
Customer validation | (293T 、T47D 、Hela 、Jurkat 、MCF-7 、PC-3 、OAW42, 293T T47D Hela Jurkat MCF7 PC3 OAW42) WB(Rattus norvegicus, Homo sapiens, Gallus gallus, Mus musculus, Sus scrofa, Bos taurus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2215? Please let us know so that we can cite the reference in this datasheet.