제품 > 항체 > 다중클론항체(pAb)

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 150s.

ABclonal:Immunohistochemistry - ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988) at dilution of 1:50 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988) at dilution of 1:50 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using ANT1/ANT2/ANT3/ANT4 Rabbit pAb (A15988) at dilution of 1:50 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	ANT1/ANT2/ANT3/ANT4 Rabbit pAb
Catalog No.	A15988
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

ANTs are the mitochondrial carrier subfamily of solute carrier proteins. ANT protein functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2).
Sequence	GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Gene ID
Swiss Prot
Synonyms	ANT1/ANT2/ANT3/ANT4
Calculated MW	33kDa/32kDa/35kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Mouse skeletal muscle, Rat heart
Cellular location	mitochondrial inner membrane, mitochondrial membrane, mitochondrial permeability transition pore complex, mitochondrion, plasma membrane
Customer validation	WB(Mus musculus)