제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Human CD270/HVEM mAb (A25413)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells (negative control, left) and HEL cells (right) were surface-stained with APC Rabbit anti-Human CD270/HVEM mAb (A25413, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HEL cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD270/HVEM mAb (A25413, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Human CD270/HVEM mAb
Catalog No.	A25413
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62197-APC

Background

This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human CD270/HVEM(NP_003811.2)
Sequence	LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC
Gene ID
Swiss Prot
Synonyms	TNFRSF14; ATAR; CD270; HVEA; HVEM; LIGHTR; TR2; TNF receptor superfamily member 14
Calculated MW	21kDa/30kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Human CD270/HVEM mAb images

Flow CytoMetry - APC Rabbit anti-Human CD270/HVEM mAb (A25413)

Flow cytometry: 1X10^6 HEL cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD270/HVEM mAb (A25413, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.