제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse CD25 mAb (A26509)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and CTLL-2 cells (right) were surface-stained with APC Rabbit anti-Mouse CD25 mAb (A26509, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Mouse CD25 mAb (A26509, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Mouse CD25 mAb
Catalog No.	A26509
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54525-APC

Background

Enables interleukin-2 binding activity and interleukin-2 receptor activity. Acts upstream of or within several processes, including Notch signaling pathway; activation-induced cell death of T cells; and regulation of T cell proliferation. Located in external side of plasma membrane. Is expressed in bone marrow. Used to study Sjogren's syndrome and inflammatory bowel disease. Human ortholog(s) of this gene implicated in immunodeficiency 41; lymphopenia; multiple sclerosis; type 1 diabetes mellitus; and type 1 diabetes mellitus 10. Orthologous to human IL2RA (interleukin 2 receptor subunit alpha).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-236 of mouse CD25 (NP_032393.3).
Sequence	ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Gene ID
Swiss Prot
Synonyms	CD25; Il2r; Ly-43
Calculated MW	31kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell surface, External side of plasma membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Mouse CD25 mAb images

Flow CytoMetry - APC Rabbit anti-Mouse CD25 mAb (A26509)

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Mouse CD25 mAb (A26509, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.