제품 > 항체 > 단일클론항체(mAb)

CD25 Rabbit mAb (A24264)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse spleen, using CD25 Rabbit mAb (A24264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Flow CytoMetry - CD25 Rabbit mAb (A24264)

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and CTLL-2 cells (right) were surface-stained with CD25 Rabbit mAb(A24264, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD25 Rabbit mAb(A24264, 2 μg/mL, right).

Overview

Product name	CD25 Rabbit mAb
Catalog No.	A24264
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54526

Background

Enables interleukin-2 binding activity and interleukin-2 receptor activity. Acts upstream of or within several processes, including Notch signaling pathway; activation-induced cell death of T cells; and regulation of T cell proliferation. Located in external side of plasma membrane. Is expressed in bone marrow. Used to study Sjogren's syndrome and inflammatory bowel disease. Human ortholog(s) of this gene implicated in immunodeficiency 41; lymphopenia; multiple sclerosis; type 1 diabetes mellitus; and type 1 diabetes mellitus 10. Orthologous to human IL2RA (interleukin 2 receptor subunit alpha).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-236 of mouse CD25 (NP_032393.3)
Sequence	ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Gene ID
Swiss Prot
Synonyms	CD25; Il2r; Ly-43
Calculated MW	31kDa
Observed MW	55kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:200 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Mouse spleen
Cellular location	Cell surface, External side of plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD25 Rabbit mAb images

Western blot - CD25 Rabbit mAb (A24264)

Flow CytoMetry - CD25 Rabbit mAb (A24264)

Flow cytometry:1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD25 Rabbit mAb(A24264, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.