제품 > 항체 > 단일클론항체(mAb)

CD28 Rabbit mAb (A20346)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CD28 antibody (A20346) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Flow CytoMetry - CD28 Rabbit mAb (A20346)

Flow cytometric analysis of CD28 Rabbit mAb Cocotail (10 μg/mL) in Jurkat cells (Orange) compare to Alexa Fluor 647 conjugated goat anti-rabbit pAb (1:600 dilution) Isotype control (Blue) and non-staining control (Red).

Overview

Product name	CD28 Rabbit mAb
Catalog No.	A20346
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5082-01

Background

The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant protein of human CD28 Full length（P10747）.
Sequence	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Gene ID
Swiss Prot
Synonyms	Tp44
Calculated MW	25kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Jurkat, U-937, Mouse spleen, Mouse thymus, Rat spleen
Cellular location	cell surface, cytosol, external side of plasma membrane, immunological synapse, plasma membrane
Customer validation	FC(Homo sapiens, Mus musculus)