제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD28 mAb (A23406)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 K-562 cells(negative control, left) and U266 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD28 mAb(A23406, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 U266 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD28 mAb(A23406, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD28 mAb
Catalog No.	A23406
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5082-01-ABf647

Background

The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant protein of human CD28 Full length（P10747）
Sequence	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Gene ID
Swiss Prot
Synonyms	Tp44
Calculated MW	25kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	cell surface, cytosol, external side of plasma membrane, immunological synapse, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human CD28 mAb images

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD28 mAb (A23406)

Flow cytometry:1X10^6 U266 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD28 mAb(A23406, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.