제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse/Human CD55 mAb (A26739)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Flow cytometry: 1X10^6 BALB/c mouse splenocytes were surface-stained with APC Rabbit anti-Human/Mouse CD55/DAF mAb (A26739, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 BALB/c mouse splenocytes were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human/Mouse CD55/DAF mAb (A26739, 5 μl/Test, right).

Flow cytometry: 1X10^6 SH-SY5Y cells (negative control, left) and HeLa cells (right) were surface-stained with APC Rabbit anti-Human/Mouse CD55/DAF mAb (A26739, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human/Mouse CD55/DAF mAb (A26739, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Mouse/Human CD55 mAb
Catalog No.	A26739
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60934-APC

Background

This gene encodes an inhibitor of both the classical and the alternative pathways of complement activation. The encoded preproprotein undergoes post-translational processing to generate a mature polypeptide anchored to the plasma membrane via a glycosylphosphatidylinositol moiety. Erythrocytes from mice deficient in the encoded protein exhibit impaired regulation of complement activation resulting in enhanced complement deposition. Mice lacking the encoded protein exhibit enhanced susceptibility to experimentally induced myasthenia gravis. This gene is located adjacent to a closely related gene on chromosome 1.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-361 of mouse CD55/DAF (NP_034146.2).
Sequence	DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT
Gene ID
Swiss Prot
Synonyms	Daf; Daf1; Daf-GPI; GPI-DAF
Calculated MW	42KDa
Observed MW

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Mouse/Human CD55 mAb images

Flow CytoMetry - APC Rabbit anti-Mouse/Human CD55 mAb (A26739)

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human/Mouse CD55/DAF mAb (A26739, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.