제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse IL1R1/CD121a mAb (A25859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and NIH/3T3 cells (right) were surface-stained with APC Rabbit anti-Mouse IL1R1/CD121a mAb (A25859, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Mouse IL1R1/CD121a mAb (A25859, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Mouse IL1R1/CD121a mAb
Catalog No.	A25859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65805-APC

Background

Enables interleukin-1 binding activity; interleukin-1 receptor activity; and protease binding activity. Involved in interleukin-1-mediated signaling pathway. Acts upstream of or within several processes, including cytokine-mediated signaling pathway; positive regulation of interleukin-1-mediated signaling pathway; and positive regulation of neutrophil extravasation. Located in external side of plasma membrane. Is expressed in brain; dorsal aorta; liver; reproductive system; and spleen. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in systemic scleroderma and type 1 diabetes mellitus. Orthologous to human IL1R1 (interleukin 1 receptor type 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-338 of mouse IL1R1/CD121a (NP_032388.1).
Sequence	LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK
Gene ID
Swiss Prot
Synonyms	IL-iR; CD121a; CD121b; IL-1R1; Il1r-1; IL-1R-1; IL-1RT1; IL-1RT-1; IL-1R-alpha
Calculated MW	67kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Mouse IL1R1/CD121a mAb images

Flow CytoMetry - APC Rabbit anti-Mouse IL1R1/CD121a mAb (A25859)

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Mouse IL1R1/CD121a mAb (A25859, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.