제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse KLRG1/MAFA mAb (A27186)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 488 Rabbit anti-Mouse CD161c/NK1.1 mAb (A24922, 5 μl/Test) and APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-mouse KLRG1/MAFA mAb (A27186, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	APC Rabbit anti-Mouse KLRG1/MAFA mAb
Catalog No.	A27186
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67806-APC

Background

Predicted to enable carbohydrate binding activity. Predicted to act upstream of or within cell surface receptor signaling pathway. Predicted to be located in intracellular membrane-bounded organelle. Orthologous to human KLRG1 (killer cell lectin like receptor G1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 57-188 of mouse KLRG1/MAFA (NP_058666.1).
Sequence	QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Gene ID
Swiss Prot
Synonyms	MAFA; 2F1-Ag; MAFA-L
Calculated MW	21kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.