Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Western blot analysis of extracts of various tissues from Arabidopsis thaliana, using APRR7 Rabbit pAb (A22255) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | APRR7 Rabbit pAb |
|---|---|
| Catalog No. | A22255 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 236-339 of Arabidopsis thaliana APRR7 (NP_568107.1). |
|---|---|
| Sequence | ENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWDRVDSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTMGRDLEISIRRNCDLALEPK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | APRR7; F9G14.120; F9G14_120; pseudo-response regulator 7 |
| Calculated MW | |
| Observed MW | 80kDa |
| Reactivity | Arabidopsis thaliana |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Seedling, Inflorescences, Before inflorescence, Rosette leaf |
| Cellular location |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
_WB_01.jpg?t=1715736651 "ABclonal:Western blot - APRR7 Rabbit pAb (A22255)")
