Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | AQP3 Rabbit pAb |
---|---|
Catalog No. | A2838 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-292 of human AQP3 (NP_004916.1). |
---|---|
Sequence | IVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
Gene ID | |
Swiss Prot | |
Synonyms | GIL; AQP-3; AQP3 |
Calculated MW | 32kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Rat brain |
Cellular location | Basolateral cell membrane, Multi-pass membrane protein. |
Customer validation | IHC(Mus musculus, Rattus norvegicus) WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Sus scrofa) IHC(Mus musculus, Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2838? Please let us know so that we can cite the reference in this datasheet.