제품 > 항체 > 다중클론항체(pAb)

AQP5 Rabbit pAb (A13861)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using AQP5 Rabbit pAb (A13861) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - AQP5 Rabbit pAb (A13861)

Immunohistochemistry analysis of paraffin-embedded Rat lung using AQP5 Rabbit pAb (A13861) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	AQP5 Rabbit pAb
Catalog No.	A13861
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-265 of human AQP5 (NP_001642.1).
Sequence	SPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR
Gene ID
Swiss Prot
Synonyms	PPKB; AQP-5; AQP5
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse lung, Rat lung
Cellular location	Apical cell membrane, Multi-pass membrane protein.
Customer validation	WB(Rattus norvegicus) IHC(Rattus norvegicus)