제품 > 항체 > 단일클론항체(mAb)

A-RAF Rabbit mAb (A8687)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using A-RAF Rabbit mAb (A8687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - A-RAF Rabbit mAb (A8687)

Immunohistochemistry analysis of paraffin-embedded Human liver using A-RAF Rabbit mAb (A8687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	A-RAF Rabbit mAb
Catalog No.	A8687
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1782

Background

Enables protein serine/threonine kinase activity. Involved in negative regulation of apoptotic process; regulation of TOR signaling; and regulation of cellular protein metabolic process. Predicted to be active in cytosol and mitochondrion. Biomarker of high grade glioma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398).
Sequence	RQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKK
Gene ID
Swiss Prot
Synonyms	PKS2; A-RAF; ARAF1; RAFA1
Calculated MW	68kDa
Observed MW	68kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, MCF7
Cellular location	Cytosol, Mitochondrion
Customer validation	WB(Mus musculus)