ARAF Rabbit pAb (A16346)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - ARAF Rabbit pAb (A16346)

Immunofluorescence analysis of HeLa cells using ARAF antibody (A16346) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ARAF Rabbit pAb
Catalog No.	A16346
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Enables protein serine/threonine kinase activity. Involved in negative regulation of apoptotic process; regulation of TOR signaling; and regulation of cellular protein metabolic process. Predicted to be active in cytosol and mitochondrion. Biomarker of high grade glioma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 371-606 of human ARAF (NP_001645.1).
Sequence	GFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP
Gene ID
Swiss Prot
Synonyms	PKS2; A-RAF; ARAF1; RAFA1
Calculated MW	68kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	cytosol, mitochondrion
Customer validation	WB(Rattus norvegicus)