Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ARF1 Rabbit mAb |
---|---|
Catalog No. | A9195 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1472 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077). |
---|---|
Sequence | GQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH |
Gene ID | |
Swiss Prot | |
Synonyms | PVNH8 |
Calculated MW | 21kDa |
Observed MW | 19kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, 293T, HepG2, Mouse lung, Mouse spleen, Rat lung |
Cellular location | Cell junction, Cytoplasm, Golgi apparatus, Lipid-anchor, Membrane, perinuclear region, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9195? Please let us know so that we can cite the reference in this datasheet.