Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ARF6 Rabbit mAb |
---|---|
Catalog No. | A11485 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0617 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330). |
---|---|
Sequence | HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
Gene ID | |
Swiss Prot | |
Synonyms | ARF6; ADP-ribosylation factor 6 |
Calculated MW | 20kDa |
Observed MW | 18kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, Hep G2, Mouse brain, Mouse kidney, Rat brain |
Cellular location | Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Endosome membrane, Golgi apparatus, Lipid-anchor, Midbody, Recycling endosome membrane, filopodium membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.