Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ARL2BP Rabbit pAb |
---|---|
Catalog No. | A15145 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL2BP (NP_036238.1). |
---|---|
Sequence | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHH |
Gene ID | |
Swiss Prot | |
Synonyms | BART; RP66; BART1; ARL2BP |
Calculated MW | 19kDa |
Observed MW | 19kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, MCF7 |
Cellular location | Cytoplasm, Mitochondrion intermembrane space, Nucleus, centrosome, cilium basal body, cytoskeleton, microtubule organizing center, spindle |
* For research use only. Not for therapeutic or diagnostic purposes.