제품 > 항체 > 다중클론항체(pAb)

ARL2 Rabbit pAb (A2830)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using ARL2 Rabbit pAb (A2830) at 1:3000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

Overview

Product name	ARL2 Rabbit pAb
Catalog No.	A2830
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human ARL2 (NP_001658.2).
Sequence	MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
Gene ID
Swiss Prot
Synonyms	ARFL2; MRCS1; ARL2
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Mouse kidney, Rat brain
Cellular location	Cytoplasm, Mitochondrion intermembrane space, Nucleus, centrosome, cytoskeleton, microtubule organizing center