제품 > 항체 > 다중클론항체(pAb)

ARL6IP1 Rabbit pAb (A17107)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using ARL6IP1 Rabbit pAb (A17107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - ARL6IP1 Rabbit pAb (A17107)

Immunohistochemistry analysis of ARL6IP1 in paraffin-embedded Rat testis tissue using ARL6IP1 Rabbit pAb (A17107) at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of ARL6IP1 in paraffin-embedded Mouse testis tissue using ARL6IP1 Rabbit pAb (A17107) at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.

Overview

Product name	ARL6IP1 Rabbit pAb
Catalog No.	A17107
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1).
Sequence	MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE
Gene ID
Swiss Prot
Synonyms	AIP1; ARMER; SPG61; ARL6IP; ARL6IP1
Calculated MW	23kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	K-562, 293F
Cellular location	cytosol