제품 > 항체 > 다중클론항체(pAb)

ARL6IP5 Rabbit pAb (A14842)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from mouse thymus, using ARL6IP5 Rabbit pAb (A14842) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	ARL6IP5 Rabbit pAb
Catalog No.	A14842
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human ARL6IP5 (NP_006398.1).
Sequence	TFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Gene ID
Swiss Prot
Synonyms	JWA; jmx; hp22; PRAF3; Yip6b; DERP11; HSPC127; addicsin; GTRAP3-18; ARL6IP5
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse thymus
Cellular location	Cytoplasm, Endoplasmic reticulum membrane, Multi-pass membrane protein