제품 > 항체 > 다중클론항체(pAb)

ARL8B Rabbit pAb (A8869)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using ARL8B Rabbit pAb (A8869) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - ARL8B Rabbit pAb (A8869)

Confocal immunofluorescence analysis of U2OS cells using ARL8B Rabbit pAb (A8869) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ARL8B Rabbit pAb
Catalog No.	A8869
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables guanyl ribonucleotide binding activity and tubulin binding activity. Involved in several processes, including calcium ion regulated lysosome exocytosis; lysosomal transport; and vesicle fusion. Located in cytolytic granule membrane; midbody; and spindle midzone. Colocalizes with lysosomal membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1).
Sequence	VLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Gene ID
Swiss Prot
Synonyms	Gie1; ARL10C; ARL8B
Calculated MW	22kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:3000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, LO2, Mouse brain, Mouse heart, Mouse kidney
Cellular location	Cytoplasm, Late endosome membrane, Lysosome membrane, cytoskeleton, spindle