제품 > 항체 > 단일클론항체(mAb)

ARPC2 Rabbit mAb (A1382)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ARPC2 Rabbit mAb (A1382) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - ARPC2 Rabbit mAb (A1382)

Immunofluorescence analysis of NIH/3T3 cells using ARPC2 Rabbit mAb (A1382) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using ARPC2 Rabbit mAb (A1382) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - ARPC2 Rabbit mAb (A1382)

Immunoprecipitation analysis of 300 μg extracts from HepG2 cells using 3 μg ARPC2 antibody (A1382). Western blot was performed from the immunoprecipitate using ARPC2 antibody (A1382) at a dilution of 1:1000.

Overview

Product name	ARPC2 Rabbit mAb
Catalog No.	A1382
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2558

Background

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144).
Sequence	FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Gene ID
Swiss Prot
Synonyms	ARC34; PRO2446; p34-Arc; PNAS-139; ARPC2
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HepG2, Mouse spleen, Mouse stomach, Mouse thymus, Rat lung
Cellular location	Cell junction, Cell projection, Cytoplasm, cytoskeleton, synapse, synaptosome