Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | ATCAY Rabbit pAb |
---|---|
Catalog No. | A14947 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ATCAY (NP_149053.1). |
---|---|
Sequence | MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETD |
Gene ID | |
Swiss Prot | |
Synonyms | CLAC; BNIP-H; ATCAY |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cell junction, Cell projection, Cytoplasm, Mitochondrion envelope, axon, dendrite, synapse |
* For research use only. Not for therapeutic or diagnostic purposes.