제품 > 항체 > 단일클론항체(mAb)

ATG10 Rabbit mAb (A6848)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using ATG10 Rabbit mAb (A6848) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - ATG10 Rabbit mAb (A6848)

Immunofluorescence analysis of NIH-3T3 cells using ATG10 Rabbit mAb (A6848) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ATG10 Rabbit mAb
Catalog No.	A6848
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1425

Background

Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0).
Sequence	RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Gene ID
Swiss Prot
Synonyms	APG10; APG10L; pp12616
Calculated MW	25kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, K-562, SH-SY5Y, Mouse heart
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens, Mus musculus) qPCR(Homo sapiens, Mus musculus)