제품 > 항체 > 다중클론항체(pAb)

ATG16L1 Rabbit pAb (A11969)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ATG16L1 Rabbit pAb (A11969) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - ATG16L1 Rabbit pAb (A11969)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ATG16L1 Rabbit pAb (A11969)

Immunofluorescence analysis of H9C2 cells using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using ATG16L1 Rabbit pAb (A11969) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ATG16L1 Rabbit pAb
Catalog No.	A11969
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5).
Sequence	QEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Gene ID
Swiss Prot
Synonyms	IBD10; WDR30; APG16L; ATG16A; ATG16L; ATG16L1
Calculated MW	68kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HT-29, MCF7, HeLa
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane