ATG16L1 Rabbit pAb (A1871)

Publications (6) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - ATG16L1 Rabbit pAb (A1871)

Immunofluorescence analysis of A-549 cells using ATG16L1 antibody (A1871). Blue: DAPI for nuclear staining.

Overview

Product name	ATG16L1 Rabbit pAb
Catalog No.	A1871
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-300 of human ATG16L1 (NP_110430.5).
Sequence	IKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Gene ID
Swiss Prot
Synonyms	IBD10; WDR30; APG16L; ATG16A; ATG16L
Calculated MW	68kDa
Observed MW	66kDa/68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Jurkat, Mouse thymus, Rat thymus
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane
Customer validation	IF(Sus scrofa, Homo sapiens) WB(Mus musculus, Homo sapiens, Sus scrofa)