제품 > 항체 > 다중클론항체(pAb)

ATG2B Rabbit pAb (A8498)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ATG2B antibody (A8498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	ATG2B Rabbit pAb
Catalog No.	A8498
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein required for autophagy. The encoded protein is involved in autophagosome formation. A germline duplication of a region that includes this gene is associated with predisposition to myeloid malignancies.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1360-1600 of human ATG2B (NP_060506.5).
Sequence	IQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGK
Gene ID
Swiss Prot
Synonyms	BLTP4B; C14orf103
Calculated MW	233kDa
Observed MW	270kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, MCF7, A-549, SW480, Mouse kidney, Rat liver
Cellular location	Lipid droplet, Peripheral membrane protein, Preautophagosomal structure membrane
Customer validation	WB(Homo sapiens, A. mellifera, Mus musculus, Apis mellifera)