Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of extracts of U-251MG cells, using ATG9A antibody (A5571) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HepG2 cells using ATG9A Rabbit pAb (A5571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | ATG9A Rabbit pAb |
|---|---|
| Catalog No. | A5571 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG9A (NP_076990.4). |
|---|---|
| Sequence | EYASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPGAPETTALHGGFQRRYGGITDPGTVPRVPSH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | mATG9; APG9L1; MGD3208 |
| Calculated MW | 94kDa |
| Observed MW | 100kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | U-251MG |
| Cellular location | Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus, Late endosome membrane, Multi-pass membrane protein, autophagosome membrane, trans-Golgi network membrane |
| Customer validation | IF(Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5571? Please let us know so that we can cite the reference in this datasheet.
