Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | ATM Rabbit pAb |
---|---|
Catalog No. | A15645 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2320-2566 of ATM (NP_000042.3). |
---|---|
Sequence | DASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANA |
Gene ID | |
Swiss Prot | |
Synonyms | AT1; ATA; ATC; ATD; ATE; ATDC; TEL1; TELO1; ATM |
Calculated MW | 351kDa |
Observed MW |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | |
Cellular location | Cytoplasmic vesicle, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.