제품 > 항체 > 단일클론항체(mAb)

ATOH1 Rabbit mAb (A11477)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using ATOH1 Rabbit mAb (A11477) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	ATOH1 Rabbit mAb
Catalog No.	A11477
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0609

Background

Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation; positive regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; inner ear morphogenesis; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858).
Sequence	MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVD
Gene ID
Swiss Prot
Synonyms	ATH1; HATH1; DFNA89; MATH-1; bHLHa14; ATOH1
Calculated MW	38kDa
Observed MW	45kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HCT116, A549
Cellular location	Nucleus
Customer validation	WB(Mus musculus)