제품 > 항체 > 단일클론항체(mAb)

ATP6 Rabbit mAb (A23150)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using ATP6 Rabbit mAb (A23150) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ATP6 Rabbit mAb
Catalog No.	A23150
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59849

Background

Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Predicted to be involved in mitochondrial ATP synthesis coupled proton transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; heart; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; NARP syndrome; Parkinson's disease; multiple sclerosis; and systemic lupus erythematosus. Orthologous to human MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 126-226 of human ATP6. (NP_904333.1).
Sequence	AHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
Gene ID
Swiss Prot
Synonyms	ATP6
Calculated MW	25kDa
Observed MW	20kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)