Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATP6V1A Rabbit pAb |
---|---|
Catalog No. | A14706 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2). |
---|---|
Sequence | SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD |
Gene ID | |
Swiss Prot | |
Synonyms | HO68; VA68; VPP2; Vma1; DEE93; ARCL2D; ATP6A1; IECEE3; ATP6V1A1; ATP6V1A |
Calculated MW | 68kDa |
Observed MW | 68kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, LO2, HeLa, Mouse brain, Mouse heart, Mouse kidney |
Cellular location | apical plasma membrane, cytosol, extracellular exosome, microvillus, nucleoplasm, plasma membrane |
Customer validation | WB(Mus musculus, Horabagrus nigricollaris) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14706? Please let us know so that we can cite the reference in this datasheet.