Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATP6V1G2 Rabbit pAb |
---|---|
Catalog No. | A20163 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1). |
---|---|
Sequence | AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL |
Gene ID | |
Swiss Prot | |
Synonyms | NG38; ATP6G; VMA10; ATP6G2; ATP6V1G2 |
Calculated MW | 14kDa |
Observed MW | 14kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | SH-SY5Y, Mouse brain, Rat brain, Mouse eye |
Cellular location | cytosol, extrinsic component of synaptic vesicle membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.