Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATP7B Rabbit pAb |
---|---|
Catalog No. | A5676 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1251-1351 of human ATP7B (NP_001230111.1). |
---|---|
Sequence | SSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEE |
Gene ID | |
Swiss Prot | |
Synonyms | WD; PWD; WC1; WND; ATP7B |
Calculated MW | 157kDa |
Observed MW | 157kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Rat liver |
Cellular location | Cytoplasm, Golgi apparatus, Golgi apparatus membrane, Mitochondrion, Multi-pass membrane protein, Multi-pass membrane protein, trans-Golgi network membrane |
Customer validation | WB(Danio rerio) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5676? Please let us know so that we can cite the reference in this datasheet.