제품 > 항체 > 다중클론항체(pAb)

ATP7B Rabbit pAb (A5676)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat liver using ATP7B Rabbit pAb(A5676) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ATP7B Rabbit pAb (A5676)

Immunohistochemistry analysis of ATP7B in paraffin-embedded mouse kidney tissue using ATP7B Rabbit pAb (A5676) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ATP7B in paraffin-embedded human liver tissue using ATP7B Rabbit pAb (A5676) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ATP7B in paraffin-embedded rat liver tissue using ATP7B Rabbit pAb (A5676) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ATP7B in paraffin-embedded human colon carcinoma tissue using ATP7B Rabbit pAb (A5676) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	ATP7B Rabbit pAb
Catalog No.	A5676
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein is a monomer, and functions as a copper-transporting ATPase which exports copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease which is characterized by copper accumulation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1251-1351 of human ATP7B (NP_001230111.1).
Sequence	SSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEE
Gene ID
Swiss Prot
Synonyms	WD; PWD; WC1; WND; ATP7B
Calculated MW	157kDa
Observed MW	157kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Rat liver
Cellular location	Cytoplasm, Golgi apparatus, Golgi apparatus membrane, Mitochondrion, Multi-pass membrane protein, Multi-pass membrane protein, trans-Golgi network membrane
Customer validation	WB(Danio rerio) IHC(Mus musculus) WB(Mus musculus)